PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_023434-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 222aa    MW: 25351.8 Da    PI: 9.6196
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_023434-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-17956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT eEd++l d+++ +G+g W++Ia+   ++R++k+c++rw +yl
    NNU_023434-RA  9 RGFWTVEEDKILMDYIRVHGKGKWNRIAKVTDLKRCGKSCRLRWMNYL 56
                     799*****************************9*************97 PP

2Myb_DNA-binding58.61.4e-1862107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eEd+l+++++++lG++ W++Ia +++ gRt++q+k++w+++l
    NNU_023434-RA  62 RGEFSVEEDDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNHWNTHL 107
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.446156IPR017930Myb domain
SuperFamilySSF466894.58E-317103IPR009057Homeodomain-like
SMARTSM007171.8E-13858IPR001005SANT/Myb domain
PfamPF002491.3E-14956IPR001005SANT/Myb domain
CDDcd001676.53E-111256No hitNo description
Gene3DG3DSA:1.10.10.601.2E-221263IPR009057Homeodomain-like
PROSITE profilePS5129427.75657111IPR017930Myb domain
SMARTSM007178.5E-1861109IPR001005SANT/Myb domain
PfamPF002493.1E-1762107IPR001005SANT/Myb domain
CDDcd001672.09E-1264107No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2664111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEEKNHYKRG FWTVEEDKIL MDYIRVHGKG KWNRIAKVTD LKRCGKSCRL RWMNYLSPTV  60
KRGEFSVEED DLIIRLHNLL GNRWSLIAGR VPGRTDNQVK NHWNTHLSKK LGIRKEKGKL  120
GVSSSLSSSK KSNRVEEVLK LPTDSNSDLS TTCDSNSTKP VQPKLMKASI QNTVEALNKQ  180
DPAVGECFES SFWPFTDDLN SNSPTLTELL DGYPFDAAWH TL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2791117108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243029.11e-165PREDICTED: transcription factor WER-like
SwissprotQ962761e-67MYB23_ARATH; Transcription factor MYB23
TrEMBLA5BI144e-87A5BI14_VITVI; Putative uncharacterized protein
TrEMBLD7SHR34e-87D7SHR3_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g08480.t011e-86(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-67myb domain protein 66